PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34650.1
Common NameF12K21.1, F21H2.11, HDG10, HDGL2-10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 708aa    MW: 80058.3 Da    PI: 8.0653
Description homeodomain GLABROUS 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-191972356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 +R+ ++++q+++Le++F+++++p+ ++r++L ++l+L+ +q+k+WFqNrR++ +
  AT1G34650.1 19 NRRHHSNHQVQRLEAFFHECPHPDDSQRRQLGNELNLKHKQIKFWFQNRRTQAR 72
                 7999**********************************************9877 PP

2START104.51.8e-332284532206
                  HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
        START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  +a  a +e++++++ e+ +W ks        +  n++ + +k +  k+     ++ e + +++vv m++ +lv  +l++  +W + ++    +a+t+ 
  AT1G34650.1 228 IAKNAVAEVMSLIQMEHSMWIKSTidgraiiDPGNYKRYFTKNSHLKSrsalqSHHESSMEVVVVQMDARNLVDMFLNTE-KWARLFPtivtEAKTIH 324
                  6788999********************99886666666666665555588998999************************.99999999999****** PP

                  EECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
        START  84 vissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                  v++s      ++  + + +l  lsplv  R+f ++R+++q++++ w+i+dvS   ++    +s    ++++pSg li+ ++ g+skvtw+ehv++ ++
  AT1G34650.1 325 VLDSMdhprqTFSRVVYEQLHILSPLVLpREFIILRTCQQMKEDLWLIADVSCYLQNVEF-ESTAPICTKRPSGVLIQALPHGRSKVTWIEHVEVTDK 421
                  ****99****6666677777777799866***********************76655544.66666789**************************999 PP

                  XX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 176 lp.hwllrslvksglaegaktwvatlqrqcek 206
                  +  h+l+r l+  g   ga++w+atlqr ce+
  AT1G34650.1 422 VWpHQLYRDLLYGGFGYGARRWTATLQRMCER 453
                  855***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-18472IPR009057Homeodomain-like
SuperFamilySSF466891.37E-161272IPR009057Homeodomain-like
PROSITE profilePS5007115.9851474IPR001356Homeobox domain
SMARTSM003891.8E-161678IPR001356Homeobox domain
PfamPF000461.0E-161972IPR001356Homeobox domain
CDDcd000861.60E-162075No hitNo description
PROSITE profilePS5084842.613218456IPR002913START domain
SuperFamilySSF559611.97E-26220454No hitNo description
CDDcd088755.76E-95222452No hitNo description
PfamPF018522.5E-27228453IPR002913START domain
SMARTSM002341.4E-12242453IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-6288419IPR023393START-like domain
SuperFamilySSF559611.61E-6476648No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MDSSHNDSSS DEEGIDSNNR RHHSNHQVQR LEAFFHECPH PDDSQRRQLG NELNLKHKQI  60
KFWFQNRRTQ ARIHNEKADN IALRVENMKI RCVNEAMEKA LETVLCPPCG GPHGKEEQLC  120
NLQKLRTKNV ILKTEYERLS SYLTKHGGYS IPSVDALPDL HGPSTYGSTS NNRPASYGSS  180
SNHLPQQSSL LRRPFTRELI NTTPLPKPVL LQHFQQLSQL EKNRMFEIAK NAVAEVMSLI  240
QMEHSMWIKS TIDGRAIIDP GNYKRYFTKN SHLKSRSALQ SHHESSMEVV VVQMDARNLV  300
DMFLNTEKWA RLFPTIVTEA KTIHVLDSMD HPRQTFSRVV YEQLHILSPL VLPREFIILR  360
TCQQMKEDLW LIADVSCYLQ NVEFESTAPI CTKRPSGVLI QALPHGRSKV TWIEHVEVTD  420
KVWPHQLYRD LLYGGFGYGA RRWTATLQRM CERLSLYSMT DFPPTDYPGV VKTIEGRRSV  480
MSLGERMLKN FAWIMKMSDK LDLPQQSGAN NSGVRISVRT NTEAGQPPGL IVCAGSSLSL  540
PLPPLQVYDF LRNLEVRHQW DVHCQGNPVT EAARFVTGPD QKNNVTFLQP SSVGEYKLMI  600
LQDGFIDALG GMVVYAPMNL NTAYSAISGQ VDPSTIPILP SGFIISRDSH PSSSEVDGGS  660
MTLLTLAFQI FVTGPSYYTD LNLKDSATTV NTLVSSAVQR IKAMLNCE
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864883370.0
Genevisible262405_at0.0
Expression AtlasAT1G34650-
AtGenExpressAT1G34650-
ATTED-IIAT1G34650-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in exclusively in anthers with highest levels in the tapetum and pollen grains. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF21H20.0AC007894.2 Arabidopsis thaliana chromosome 1 BAC F21H2 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174724.10.0homeodomain GLABROUS 10
SwissprotQ9S9Z00.0HDG10_ARATH; Homeobox-leucine zipper protein HDG10
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT1G34650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  4. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]